RVG29-Cys | A peptide derived from RVG29 | CAS#1404289-25-3

MedKoo Cat#: 128969 | Name: RVG29-Cys

Featured

Description:

WARNING: This product is for research use only, not for human or veterinary use.

RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation.

Chemical Structure

RVG29-Cys

CAS#1404289-25-3

Theoretical Analysis

MedKoo Cat#: 128969

Name: RVG29-Cys

CAS#: 1404289-25-3

Chemical Formula: C144H222N44O44S3

Exact Mass: 3367.5649

Molecular Weight: 3369.80

Elemental Analysis: C, 51.33; H, 6.64; N, 18.29; O, 20.89; S, 2.85

Price and Availability

Size	Price	Availability	Quantity
5mg	USD 650.00	2 Weeks

Bulk Inquiry

Buy Now

Add to Cart

Related CAS #

No Data

Synonym

RVG29-Cys; RVG29Cys; RVG29 Cys

IUPAC/Chemical Name

Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys YTIWMPENPRPGTPCDIFTNSRGKRASNGC

InChi Key

SQWGWNJDPJYWQQ-FMHCIDBQSA-N

InChi Code

InChI=1S/C144H222N44O44S3/c1-10-69(3)110(133(223)173-88(55-75-26-13-12-14-27-75)124(214)184-112(72(6)191)135(225)175-91(58-103(148)196)123(213)178-95(66-190)126(216)166-82(31-19-46-156-142(150)151)117(207)160-62-105(198)164-83(30-17-18-45-145)120(210)167-84(32-20-47-157-143(152)153)119(209)163-71(5)115(205)177-94(65-189)127(217)171-90(57-102(147)195)118(208)161-63-106(199)165-97(68-234)141(231)232)181-125(215)92(60-109(203)204)172-128(218)96(67-233)179-132(222)101-37-25-52-188(101)140(230)114(74(8)193)180-107(200)64-162-129(219)98-34-22-49-185(98)137(227)86(33-21-48-158-144(154)155)170-131(221)100-36-24-51-187(100)139(229)93(59-104(149)197)176-121(211)85(42-43-108(201)202)168-130(220)99-35-23-50-186(99)138(228)87(44-53-235-9)169-122(212)89(56-77-61-159-81-29-16-15-28-79(77)81)174-134(224)111(70(4)11-2)182-136(226)113(73(7)192)183-116(206)80(146)54-76-38-40-78(194)41-39-76/h12-16,26-29,38-41,61,69-74,80,82-101,110-114,159,189-194,233-234H,10-11,17-25,30-37,42-60,62-68,145-146H2,1-9H3,(H2,147,195)(H2,148,196)(H2,149,197)(H,160,207)(H,161,208)(H,162,219)(H,163,209)(H,164,198)(H,165,199)(H,166,216)(H,167,210)(H,168,220)(H,169,212)(H,170,221)(H,171,217)(H,172,218)(H,173,223)(H,174,224)(H,175,225)(H,176,211)(H,177,205)(H,178,213)(H,179,222)(H,180,200)(H,181,215)(H,182,226)(H,183,206)(H,184,214)(H,201,202)(H,203,204)(H,231,232)(H4,150,151,156)(H4,152,153,157)(H4,154,155,158)/t69-,70-,71-,72+,73+,74+,80-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,110-,111-,112-,113-,114-/m0/s1

SMILES Code

O=C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CCSC)C(N3[C@@H](CCC3)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N5[C@@H](CCC5)C(NCC(N[C@@H]([C@H](O)C)C(N6[C@@H](CCC6)C(N[C@@H](CS)C(N[C@@H](CC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC7=CC=CC=C7)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CS)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC8=CC=C(C=C8)O)N

Appearance

To be determined

Purity

>98% (or refer to the Certificate of Analysis)

Shipping Condition

Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition

Dry, dark and at 0 -4 C for short term (days to weeks) or -20 C for long term(months to years).

Solubility

To be determined

Shelf Life

>2 years if stored properly

Drug Formulation

To be determined

Stock Solution Storage

0 - 4 C for short term (days to weeks), or -20 C for long term (months).

HS Tariff Code

2934.99.9001

More Info

Instruction

View handling instruction

Preparing Stock Solutions

The following data is based on the product molecular weight 3,369.80 Batch specific molecular weights may vary from batch to batch due to the degree of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass	1 mg	5 mg	10 mg
1 mM	1.15 mL	5.76 mL	11.51 mL
5 mM	0.23 mL	1.15 mL	2.3 mL
10 mM	0.12 mL	0.58 mL	1.15 mL
50 mM	0.02 mL	0.12 mL	0.23 mL

1. Kim JY, Choi WI, Kim YH, Tae G. Brain-targeted delivery of protein using chitosan- and RVG peptide-conjugated, pluronic-based nano-carrier. Biomaterials. 2013 Jan;34(4):1170-8. doi: 10.1016/j.biomaterials.2012.09.047. Epub 2012 Nov 2. PMID: 23122677. 2. Li C, Xiang Z, Hou M, Yu H, Peng P, Lv Y, Ma C, Ding H, Jiang Y, Liu Y, Zhou H, Feng S. miR-NPs-RVG promote spinal cord injury repair: implications from spinal cord-derived microvascular endothelial cells. J Nanobiotechnology. 2024 Sep 28;22(1):590. doi: 10.1186/s12951-024-02797-7. PMID: 39342236; PMCID: PMC11438374.