MedKoo Biosciences, Inc.
Tel:   +1-919-636-5577    Fax:   +1-919-980-4831    Email:   sales@medkoo.com
Search
Login Register
Search
MedKoo Cat#: 128969 | Name: RVG29-Cys
Featured

Description:

WARNING: This product is for research use only, not for human or veterinary use.

RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation.

Chemical Structure

RVG29-Cys
RVG29-Cys
CAS#1404289-25-3

Theoretical Analysis

MedKoo Cat#: 128969

Name: RVG29-Cys

CAS#: 1404289-25-3

Chemical Formula: C144H222N44O44S3

Exact Mass: 3367.5649

Molecular Weight: 3369.80

Elemental Analysis: C, 51.33; H, 6.64; N, 18.29; O, 20.89; S, 2.85

Price and Availability

Size Price Availability Quantity
5mg USD 650.00 2 Weeks
Bulk Inquiry
Buy Now
Add to Cart
Related CAS #
No Data
Synonym
RVG29-Cys; RVG29Cys; RVG29 Cys
IUPAC/Chemical Name
Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys YTIWMPENPRPGTPCDIFTNSRGKRASNGC
InChi Key
SQWGWNJDPJYWQQ-FMHCIDBQSA-N
InChi Code
InChI=1S/C144H222N44O44S3/c1-10-69(3)110(133(223)173-88(55-75-26-13-12-14-27-75)124(214)184-112(72(6)191)135(225)175-91(58-103(148)196)123(213)178-95(66-190)126(216)166-82(31-19-46-156-142(150)151)117(207)160-62-105(198)164-83(30-17-18-45-145)120(210)167-84(32-20-47-157-143(152)153)119(209)163-71(5)115(205)177-94(65-189)127(217)171-90(57-102(147)195)118(208)161-63-106(199)165-97(68-234)141(231)232)181-125(215)92(60-109(203)204)172-128(218)96(67-233)179-132(222)101-37-25-52-188(101)140(230)114(74(8)193)180-107(200)64-162-129(219)98-34-22-49-185(98)137(227)86(33-21-48-158-144(154)155)170-131(221)100-36-24-51-187(100)139(229)93(59-104(149)197)176-121(211)85(42-43-108(201)202)168-130(220)99-35-23-50-186(99)138(228)87(44-53-235-9)169-122(212)89(56-77-61-159-81-29-16-15-28-79(77)81)174-134(224)111(70(4)11-2)182-136(226)113(73(7)192)183-116(206)80(146)54-76-38-40-78(194)41-39-76/h12-16,26-29,38-41,61,69-74,80,82-101,110-114,159,189-194,233-234H,10-11,17-25,30-37,42-60,62-68,145-146H2,1-9H3,(H2,147,195)(H2,148,196)(H2,149,197)(H,160,207)(H,161,208)(H,162,219)(H,163,209)(H,164,198)(H,165,199)(H,166,216)(H,167,210)(H,168,220)(H,169,212)(H,170,221)(H,171,217)(H,172,218)(H,173,223)(H,174,224)(H,175,225)(H,176,211)(H,177,205)(H,178,213)(H,179,222)(H,180,200)(H,181,215)(H,182,226)(H,183,206)(H,184,214)(H,201,202)(H,203,204)(H,231,232)(H4,150,151,156)(H4,152,153,157)(H4,154,155,158)/t69-,70-,71-,72+,73+,74+,80-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,110-,111-,112-,113-,114-/m0/s1
SMILES Code
O=C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CCSC)C(N3[C@@H](CCC3)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N5[C@@H](CCC5)C(NCC(N[C@@H]([C@H](O)C)C(N6[C@@H](CCC6)C(N[C@@H](CS)C(N[C@@H](CC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC7=CC=CC=C7)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CS)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC8=CC=C(C=C8)O)N
Appearance
To be determined
Purity
>98% (or refer to the Certificate of Analysis)
Shipping Condition
Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition
Dry, dark and at 0 -4 C for short term (days to weeks) or -20 C for long term(months to years).
Solubility
To be determined
Shelf Life
>2 years if stored properly
Drug Formulation
To be determined
Stock Solution Storage
0 - 4 C for short term (days to weeks), or -20 C for long term (months).
HS Tariff Code
2934.99.9001
More Info

Preparing Stock Solutions

The following data is based on the product molecular weight 3,369.80 Batch specific molecular weights may vary from batch to batch due to the degree of hydration, which will affect the solvent volumes required to prepare stock solutions.

Recalculate based on batch purity %
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 1.15 mL 5.76 mL 11.51 mL
5 mM 0.23 mL 1.15 mL 2.3 mL
10 mM 0.12 mL 0.58 mL 1.15 mL
50 mM 0.02 mL 0.12 mL 0.23 mL
1. Kim JY, Choi WI, Kim YH, Tae G. Brain-targeted delivery of protein using chitosan- and RVG peptide-conjugated, pluronic-based nano-carrier. Biomaterials. 2013 Jan;34(4):1170-8. doi: 10.1016/j.biomaterials.2012.09.047. Epub 2012 Nov 2. PMID: 23122677. 2. Li C, Xiang Z, Hou M, Yu H, Peng P, Lv Y, Ma C, Ding H, Jiang Y, Liu Y, Zhou H, Feng S. miR-NPs-RVG promote spinal cord injury repair: implications from spinal cord-derived microvascular endothelial cells. J Nanobiotechnology. 2024 Sep 28;22(1):590. doi: 10.1186/s12951-024-02797-7. PMID: 39342236; PMCID: PMC11438374.